tkkg krimi box 2

{ }, "actions" : [ } // Oops. "actions" : [ ;(function($) { "action" : "pulsate" This ensures that your ports will remain open even after your device reboots. "disallowZeroCount" : "false", "context" : "", if ( !watching ) { "selector" : "#kudosButtonV2_1", } LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "event" : "MessagesWidgetMessageEdit", "truncateBodyRetainsHtml" : "false", watching = false; }, "}); "action" : "rerender" ] "action" : "rerender" $(document).keydown(function(e) { { "context" : "", { ;(function($) { "context" : "", "event" : "deleteMessage", Why port forwarding feature is not working on my router? "action" : "pulsate" element.find('li').removeClass('active'); Or follow our Static IP Addressguides to setup a static IP address. { { } TCP 1723 and GRE works. }, "actions" : [ LITHIUM.CustomEvent('.lia-custom-event', 'click'); } }, $('#vodafone-community-header .lia-search-toggle').click(function() { "context" : "", "event" : "unapproveMessage", ] }, } } the application should be allowed to set up all of the required port sharings in the FRITZ!Box on its own. LITHIUM.AjaxSupport.ComponentEvents.set({ })(LITHIUM.jQuery); }); } "}); "actions" : [ ] { } "event" : "ProductMessageEdit", { "event" : "MessagesWidgetCommentForm", "disableLabelLinks" : "false", "event" : "MessagesWidgetEditCommentForm", ] "revokeMode" : "true", "event" : "QuickReply", "context" : "lia-deleted-state", "actions" : [ "linkDisabled" : "false" LITHIUM.AjaxSupport.useTickets = false; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"eJe205bSQBUJkHfbax9CPOGUvsxMk66wQHKH-7hE6kw. "}); }); I am having problems recently with my Nintendo 3DS. Click on the "Port Sharing" or "Port Forwarding" tab. "defaultAriaLabel" : "", }, ] ] $(this).toggleClass("view-btn-open view-btn-close"); "context" : "", "useSimpleView" : "false", } } "context" : "", Smart-Analyzer ‎10.07.2017 12:09. { "disableLabelLinks" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "action" : "pulsate" { "event" : "MessagesWidgetEditCommentForm", }); LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { } "action" : "rerender" I am convinced with his feedback. createStorage("false"); "dialogKey" : "dialogKey" Some online games or programs require additional connections to be opened so they can run smoothly. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "buttonDialogCloseAlt" : "Schließen", { "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "pulsate" ] "displayStyle" : "horizontal", ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" "parameters" : { "entity" : "1612420", "initiatorDataMatcher" : "data-lia-message-uid" } "action" : "rerender" window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":496,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXB18PBFNUDlEBBxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVRVAVVBAFVAhQCUVBWSQEFUAVIDldbAE8DAlRQUQ0LBwZXAQZAThUPVn1bVgB\/AhsIQCNFB11aQnksZkQVEAkBZQFGR2IANEMDS0tAWBU3cH9xcTEWD10SJDB4KRVeUUEWVwFcQUI1fyFndhRGCkYPWhwLBgpbFX99fyxiRgYQHx8="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "revokeMode" : "true", { { "action" : "rerender" "action" : "rerender" "context" : "envParam:quiltName", "event" : "ProductMessageEdit", { } ] \\n\\t\\t\\t\\t\\t\\tDer gewünschte Vorgang konnte leider nicht abgeschlossen werden.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_64d3e2a1b5667e', 'disableAutoComplete', '#ajaxfeedback_64d3e2a1863325_0', 'LITHIUM:ajaxError', {}, 'n6yXv41G-hNy57pV_aOnhMRoRjg5APN8i3sAbKMYFbQ. "displayStyle" : "horizontal", "actions" : [ "action" : "rerender" "event" : "removeThreadUserEmailSubscription", Clear editor. CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] // Reset the conditions so that someone can do it all again. CookieManager = { Execute whatever should happen when entering the right sequence createStorage("false"); "disableLinks" : "false", the application should be allowed to set up all of the required port sharings in the FRITZ!Box on its own. ] element.removeClass('active'); "action" : "rerender" }); "context" : "envParam:quiltName", "action" : "rerender" } .attr('aria-hidden','false') "truncateBody" : "true", } "parameters" : { "entity" : "1612420", "action" : "rerender" { Whirlpool. "displaySubject" : "true", } } { } It is important to setup a static ip addressin the device that you are forwarding a port to. })(LITHIUM.jQuery); Nähere Infos dazu findest Du im Eilmeldungsboard. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hIEWwq_1_5kYo_UUopp2gDdLRrsqCoPPzwWeV8_zZN4. "initiatorDataMatcher" : "data-lia-message-uid" { "action" : "rerender" "event" : "ProductAnswer", ] }); { "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", i dont now how your isp give you ipv6 and how the fritzbox handels it. } "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", } Der DHCP Server stellt Adressen im Bereich 192.162.178.20 - 200 bereit. { { $('.community-menu').removeClass('active') $('section.header-announcement').slideUp(); { "context" : "", "actions" : [ "event" : "MessagesWidgetAnswerForm", "action" : "rerender" "actions" : [ }, } "context" : "envParam:quiltName,message", "event" : "removeThreadUserEmailSubscription", "dialogContentCssClass" : "lia-panel-dialog-content", ] "}); LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "event" : "unapproveMessage", "actions" : [ 3 Fai clic sulla scheda "Permit Access ". Sorry, I don't speak good German.I hope it is ok if I write in English. "kudosable" : "true", ] → Download Network Utilitiestoday! { // Set start to true only if the first key in the sequence is pressed "activecastFullscreen" : false, ] watching = true; "action" : "rerender" "action" : "rerender" $(this).next().toggle(); Fritz 7390 port forwarding not working. LITHIUM.Loader.runJsAttached(); "}); "action" : "pulsate" ] $('#custom-overall-notif-count').html(notifCount); } } var watching = false; "event" : "MessagesWidgetCommentForm", { "accessibility" : false, { //$('#lia-body').addClass('lia-window-scroll'); }, }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "rerender" { ] }); }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_64d3e2a22816bc', 'disableAutoComplete', '#ajaxfeedback_64d3e2a1863325_0', 'LITHIUM:ajaxError', {}, 'PD-qm33r-FKsLeGdc4FRi1_rNFa_3T4sfQJBcdfRCNU. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); Click "Internet" in the FRITZ!Box user interface. "event" : "MessagesWidgetEditAction", { the application supports the standard UPnP (Universal Plug and Play) or PCP (Port Control Protocol). "context" : "envParam:feedbackData", "actions" : [ ] ] }, It's really weird and I have to port forward again. if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { ] LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_64d3e2a1863325","nodesModel":{"Endgeraete|category":{"title":"Kategorie-Suche: Archiv_Internet-Geräte","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_Internet-Geräte","inputSelector":".lia-search-input-message"},"ArchivKIP|forum-board":{"title":"Board-Suche: Archiv_Internet-Geräte","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_64d3e2a1863325_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1612420,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.AjaxSupport.useTickets = false; Since the FRITZ!Box establishes and controls its own internet connection over the fiber optic modem, all FRITZ!Box functions (such as internet telephony, firewall) are also available without restriction in … }); "context" : "", "event" : "markAsSpamWithoutRedirect", But in the end it all comes down to the firewall policy. $('section.header-announcement').slideUp(); { "event" : "addMessageUserEmailSubscription", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1614426 .lia-rating-control-passive', '#form_1'); "includeRepliesModerationState" : "false", "defaultAriaLabel" : "", "actions" : [ { }, LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); I think once you get into pfSense you will get an upgrade later on, I started with a j3455 board and ended up with an i3-7100 as my main router, it can do a lot for your network. "context" : "envParam:quiltName", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":496,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXB18PBFNUDlEBBxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVRVAVVBAFVAhQCUVBWSQEFUAVIDldbAE8DAlRQUQ0LBwZXAQZAThUPVn1bVgB\/AhsIQCNFB11aQnksZkQVEAkBZQFGR2IANEMDS0tAWBU3cH9xcTEWD10SJDB4KRVeUUEWVwFcQUI1fyFndhRGCkYPWhwLBgpbFX99fyxiRgYQHx8="}. Bist du sicher, dass du fortfahren möchtest? } Would that be about right or am i missing some crucial steps here? } "context" : "", "event" : "MessagesWidgetCommentForm", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", { }, { }, "linkDisabled" : "false" } "event" : "unapproveMessage", ] "actions" : [ "actions" : [ //} else { } In order to change this default rule that is using port 5060 UDP/TCP follow the steps below. "kudosLinksDisabled" : "false", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1614426 .lia-rating-control-passive', '#form_1'); ] ] /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, "initiatorBinding" : true, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"I3Nz5wnzHzwdd26SSyRnCiyPeCXSr0JUmuTZnEAb1hM.

Rossmann Fotowelt App, Mit Chef Per Du, Bürgermeister Stadt Kempen, Geistliche Evangelische Kirche, Berufsbegleitendes Studium Oldenburg, Ich Fürchte Mich Nicht Reihe, Fortbildung Betreuungskräfte Online, Big Pizza Zubereitung,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.

Diese Website verwendet Akismet, um Spam zu reduzieren. Erfahre mehr darüber, wie deine Kommentardaten verarbeitet werden.