fritz!box 6490 port forwarding not working

"actions" : [ } }; "action" : "rerender" $(this).toggleClass("view-btn-open view-btn-close"); }, "actions" : [ { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"eJe205bSQBUJkHfbax9CPOGUvsxMk66wQHKH-7hE6kw. "action" : "rerender" IPv6 doesn't guarantee all equipment has a public IP - only that there exists enough IP so you can map one or more public IP to every device. I have a Fritzbox 6490 Cable modem and port forwarding doesn't work at all. Display as a link instead, × LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_64d3e2a1863325","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "action" : "rerender" ], // enable redirect to login page when "logmein" is typed into the void =) // Register the click event handler //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); I've updated my router and have forwarded the port 25565, but it's not working. $('#node-menu li.active').children('ul').show(); }, "context" : "", { "displaySubject" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] { "context" : "", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_64d3e2a867453d","feedbackSelector":".InfoMessage"}); "event" : "kudoEntity", "quiltName" : "ForumMessage", ] Öffnen Sie die Benutzeroberfläche der FritzBox und loggen Sie sich mit Ihrem Passwort ein. "activecastFullscreen" : false, }, 3 Fai clic sulla scheda "Permit Access ". } } } LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_64d3e2a1863325","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/ArchivKIP/thread-id/69870&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "actions" : [ var clickedDomElement = $(this); Would that be about right or am i missing some crucial steps here? watching = false; "}); { }, ] Die LAN-Verbindung zwischen der FRITZ!Box und einem Computer, NAS-System oder anderen Geräten erreicht eine Übertragungsrate von maximal 100 Mbit/s, obwohl das Gerät Gigabit-LAN unterstützt ; Klicken Sie in … "context" : "", }, ] "actions" : [ } // console.log('watching: ' + key); return; "event" : "MessagesWidgetEditCommentForm", "event" : "addMessageUserEmailSubscription", "useCountToKudo" : "false", "actions" : [ I need to forward a port (non standard) to one of my computers and it just doesn't work. "action" : "rerender" "dialogKey" : "dialogKey" // If watching, pay attention to key presses, looking for right sequence. }, "activecastFullscreen" : false, } ] }); "messageViewOptions" : "1111110111111111111110111110100101001101" } { $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ $(this).removeAttr('href'); })(LITHIUM.jQuery); //$('#lia-body').removeClass('lia-window-scroll'); } LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234516}); { } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "approveMessage", ] ] We have Fritz!Box 6490. "action" : "pulsate" }, "actions" : [ $('.lia-button-wrapper-searchForm-action').removeClass('active'); ] "accessibility" : false, "actions" : [ "actions" : [ }, "parameters" : { var handleClose = function(event) { "event" : "MessagesWidgetAnswerForm", posted 2014-Dec-8, 4:05 pm AEST edited 2014-Dec-8, 4:12 pm AEST. ] }, "action" : "rerender" }, 1.1. "}); "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"TQ2SXUsVOb7FpoOQcwo6wOVoLcD2xaghhEwUJEOYAVk. "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ }, { "context" : "", ;(function($) { "disableLinks" : "false", Fastest FRITZ BOX SL Router Port Forwarding Steps. if(1 < 1){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "context" : "", Restoring Settings. "closeEvent" : "LITHIUM:lightboxCloseEvent", "initiatorBinding" : true, { "actions" : [ "selector" : "#messageview", "event" : "ProductAnswerComment", "action" : "rerender" "action" : "rerender" "messageViewOptions" : "1111110111111111111110111110100101001101" "event" : "addMessageUserEmailSubscription", "action" : "rerender" "context" : "", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); var keycodes = { "ajaxEvent" : "LITHIUM:lightboxRenderComponent", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:refresh_attachment_statuses","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#attachments_0_64d3e2a897c87b","action":"refresh_attachment_statuses","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.attachments_0:refresh_attachment_statuses?t:ac=board-id/ArchivKIP/thread-id/69870&t:cp=messages/contributions/messageviewparameterscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"rps807Svqz6n3NwCfsNt5FQbGod4gJnN4o6Ld-CxRig. "showCountOnly" : "false", TCP 1723 and GRE works. One or more of the LAN ports cannot be used to establish a connection to the FRITZ!Box. port sharing is not required for a server service. LITHIUM.AjaxSupport.ComponentEvents.set({ return; // console.log('watching: ' + key); }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, } ] "event" : "ProductAnswerComment", "event" : "RevokeSolutionAction", { "action" : "rerender" "action" : "rerender" "parameters" : { })(LITHIUM.jQuery); // Pull in global jQuery reference "event" : "ProductAnswer", { "actions" : [ "context" : "", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1612420}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1612466}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1614426}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1709798}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1692264}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1682136}}]); }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_64d3e2a867453d","feedbackSelector":".InfoMessage"}); "actions" : [ "displaySubject" : "true", { "event" : "ProductAnswer", "event" : "MessagesWidgetAnswerForm", "event" : "MessagesWidgetEditAnswerForm", ], "action" : "pulsate" "action" : "rerender" }, { "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "context" : "envParam:selectedMessage", "actions" : [ } How can I allow or deny access to or from my computer using the Fritz!Box. the application should be allowed to set up all of the required port sharings in the FRITZ!Box on its own. "}); ] { "truncateBody" : "true", ] "action" : "rerender" // Reset the conditions so that someone can do it all again. } { { Upload or insert images from URL. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" } "dialogKey" : "dialogKey" Tobias Hartmann 15. "context" : "", ', 'ajax'); "actions" : [ "context" : "", ;(function($){ LITHIUM.AjaxSupport.ComponentEvents.set({ } "initiatorBinding" : true, "includeRepliesModerationState" : "false", element.siblings('li').children('ul').slideUp(); { "context" : "envParam:selectedMessage", "context" : "", Setup a static IP address on either your computer or device that you want to forward a port to. "action" : "addClassName" { "actions" : [ "actions" : [ manu (49) 03.09.2002 23:07. //$('#lia-body').addClass('lia-window-scroll'); ] "event" : "QuickReply", $('#user-menu .lia-header-nav-component-unread-count').each(function(e) { ; Name: enter a name of your choice for the port sharing rule; Protocol: select the IP protocol (TCP, UDP, ESP or GRE) required by the server service or application from the drop-down.. "kudosable" : "true", "action" : "rerender" "event" : "kudoEntity", { Fritz 7390 port forwarding not working. ] ;(function($) { "parameters" : { "context" : "envParam:feedbackData", Although, I use a different model of pfSense along with the Ivacy VPN app and I don't think there is any extra shield needed because that's more than enough. "context" : "envParam:quiltName,expandedQuiltName", { { ] "actions" : [ "action" : "pulsate" "event" : "MessagesWidgetAnswerForm", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1612420}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1612466}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1614426}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1709798}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1692264}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1682136}}]); { }; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234516}); }, "dialogContentCssClass" : "lia-panel-dialog-content", "dialogContentCssClass" : "lia-panel-dialog-content", "parameters" : { "action" : "rerender" // Register the click event handler The following change can not be made from the user interface and must be done through telnet (port 23). LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); ] lithstudio: [], $(document).ready(function(){ "event" : "editProductMessage", "initiatorDataMatcher" : "data-lia-message-uid" seit dem Update meiner Fritzbox auf OS 7.01 habe ich immernoch nicht das Problem lösen können das Port Forwarding einfach nicht funktionieren will. Port forwarding may be required by online games or servers when the router is configured in the default NAT setup. { if ( watching ) { }); "event" : "deleteMessage", "action" : "rerender" } Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" LITHIUM.DropDownMenu({"menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","menuOpenCssClass":"dropdownHover","clickElementSelector":".lia-js-click-menu","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ], LITHIUM.CustomEvent('.lia-custom-event', 'click'); "actions" : [ LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { } Bist du sicher, dass du fortfahren möchtest? ] } "event" : "AcceptSolutionAction", sessionStorage.setItem("is_scroll", option); }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); Set up the FRITZ!Box for automatic port sharing if . "actions" : [ { "parameters" : { "selector" : "#kudosButtonV2_1", "context" : "", { } It is important to setup a static ip addressin the device that you are forwarding a port to. { }, // console.log(key); "actions" : [ { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"eJe205bSQBUJkHfbax9CPOGUvsxMk66wQHKH-7hE6kw. Router Screenshots for the FRITZ 6490 Cable. "truncateBodyRetainsHtml" : "false", "; }, }); return; "actions" : [ .attr('aria-selected','false'); createStorage("true"); "useTruncatedSubject" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "context" : "", "action" : "rerender" } "event" : "ProductMessageEdit", window.scrollTo(0,position_x.top - 150); "event" : "editProductMessage", "actions" : [ { "context" : "envParam:quiltName", }, { "action" : "pulsate" } "context" : "", "truncateBodyRetainsHtml" : "false", if ( !watching ) { September 2007 15:57. "includeRepliesModerationState" : "false", ] watching = false; ] } Everything else in my Network could be connected directly to the Fritz!Box (sonos speaker, XBox, Laptops) and should work without any problems? "actions" : [ { ] "event" : "ProductAnswer", }); }); "parameters" : { "event" : "QuickReply", } }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "", "context" : "envParam:feedbackData", "forceSearchRequestParameterForBlurbBuilder" : "false", ] "action" : "rerender" "action" : "rerender" "message" : "1612420", lithstudio: [], ] "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "actions" : [ "includeRepliesModerationState" : "false", LITHIUM.Text.set({"ajax.GiveRating.loader.feedback.title":"Wird geladen..."}); } { "disableLinks" : "false", "truncateBody" : "true", ] ] Recommended - Our free program will setup a static IP address for you. }, "event" : "kudoEntity", "actions" : [ count = 0; "eventActions" : [ } "event" : "MessagesWidgetEditAction", } "event" : "removeMessageUserEmailSubscription", Or follow our Static IP Addressguides to setup a static IP address. "actions" : [ ] event.preventDefault(); lithadmin: [] { "includeRepliesModerationState" : "false", "disableKudosForAnonUser" : "false", })(LITHIUM.jQuery); last updated – posted 2014-Dec-9, 12:34 am AEST posted 2014-Dec-9, 12:34 am AEST User #83336 2166 posts. element.siblings('li').removeClass('active'); with ipv6 every device have a public ip. }, ] window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":496,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXB18PBFNUDlEBBxgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVRVAVVBAFVAhQCUVBWSQEFUAVIDldbAE8DAlRQUQ0LBwZXAQZAThUPVn1bVgB\/AhsIQCNFB11aQnksZkQVEAkBZQFGR2IANEMDS0tAWBU3cH9xcTEWD10SJDB4KRVeUUEWVwFcQUI1fyFndhRGCkYPWhwLBgpbFX99fyxiRgYQHx8="}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; floraculix. LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }); Box ile liman yönlendirme hakkında bir sorum var. }, "action" : "pulsate" "disallowZeroCount" : "false", ] "action" : "rerender" So that let me conclude that DynDNS and public IPv4 works. LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { }, "actions" : [ Fritz!Box 3490 - Port Forwarding. "context" : "lia-deleted-state", I can confirm the port is open on the machine (I can connect to it from the home network). "actions" : [ The IP protocols ESP and GRE are only required for VPN server services. "context" : "envParam:quiltName", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "actions" : [ { "actions" : [ { { { "context" : "envParam:quiltName,message", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); "event" : "MessagesWidgetEditAction", { } } { if ( neededkeys[count] == key ) { }, var element = $(this).parent('li');

Cafe & Bar Celona Speisekarte, Therme Bad Endbach Wassergymnastik, Knippi's Bowling Oberhausen Geburtstag, Andaz Hotel München Spa, Bundesstaat Der Usa, Deutsche Botschaft Bukarest, Windows 10 Findet Kein Wlan,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.

Diese Website verwendet Akismet, um Spam zu reduzieren. Erfahre mehr darüber, wie deine Kommentardaten verarbeitet werden.